PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008231061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 237aa    MW: 27188.6 Da    PI: 10.0212
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008231061.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM119.33.7e-37151441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     +p+G+rFhPtdeelv +yLk+kv++ +l++ ++i+++d+++++Pw Lp +    +++ yfF ++ ++++  + ++ra+  gyWk  gk+k++++ 
  XP_008231061.1  15 MPVGYRFHPTDEELVIHYLKRKVHAAPLPA-SIIPDFDVFHTHPWGLPGCGGDVREKRYFFYNKINANE-IDDTKRAAGCGYWKPMGKEKQIVDP 107
                     699***************************.89***************654444456699999888765.67899999***************99 PP

             NAM  96 .kgelvglkktLvfy...kgrapkgektdWvmheyrl 128
                      ++e+vg++ktLvf    +  +++ +kt+W+mhey+l
  XP_008231061.1 108 eSSEAVGIRKTLVFSqrkRRYHETQTKTRWLMHEYQL 144
                     67888**********54323345667*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-4211172IPR003441NAC domain
PROSITE profilePS5100541.86815172IPR003441NAC domain
PfamPF023653.3E-2416144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEKLPNFVIN GGVKMPVGYR FHPTDEELVI HYLKRKVHAA PLPASIIPDF DVFHTHPWGL  60
PGCGGDVREK RYFFYNKINA NEIDDTKRAA GCGYWKPMGK EKQIVDPESS EAVGIRKTLV  120
FSQRKRRYHE TQTKTRWLMH EYQLLSSQVN PTHTQASKRE PGNWVVYRVF QRKRKPQRSS  180
DIIPQPSNSK RTRTQRLVEV ITPSSSSSCS SDITHLSSNA NRLDHDQEEN SSAAADN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-231317815171NAC domain-containing protein 19
4dul_A2e-231317815171NAC domain-containing protein 19
1ut7_B2e-231317815171NO APICAL MERISTEM PROTEIN
1ut7_A2e-231317815171NO APICAL MERISTEM PROTEIN
1ut4_B2e-231317815171NO APICAL MERISTEM PROTEIN
1ut4_A2e-231317815171NO APICAL MERISTEM PROTEIN
3swp_D2e-231317818174NAC domain-containing protein 19
3swp_C2e-231317818174NAC domain-containing protein 19
3swp_B2e-231317818174NAC domain-containing protein 19
3swp_A2e-231317818174NAC domain-containing protein 19
3swm_D2e-231317818174NAC domain-containing protein 19
3swm_C2e-231317818174NAC domain-containing protein 19
3swm_B2e-231317818174NAC domain-containing protein 19
3swm_A2e-231317818174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008231061.11e-180PREDICTED: NAC domain-containing protein 68
TrEMBLM5X8831e-166M5X883_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s33260.11e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14000.11e-43NAC domain containing protein 84